PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0670s0180.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family SRS
Protein Properties Length: 204aa    MW: 22453.3 Da    PI: 8.6435
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0670s0180.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702179.61.3e-5591414154
                  DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstk 90 
                             g+++CqdCGnq+kkdC ++RCRtCCks+gf+C+thvkstWvpa++rr+r q+ +  ++++      +++k+kr              
  SapurV1A.0670s0180.1.p   9 GGSRCQDCGNQSKKDCFYMRCRTCCKSKGFQCQTHVKSTWVPAYRRRQRAQTVSPVQQQQLL---GQNPKSKR-------------- 78 
                             6789********************************************97766655333322...22222222.............. PP

                  DUF702  91 lssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                             l ++++++ le++++P+ev+s+a frc rvss+d++ ++laYqt+v+igGhvfkGiLydqG+e+
  SapurV1A.0670s0180.1.p  79 L-RENPSTGLEIENFPAEVDSTATFRCFRVSSIDEAVDQLAYQTSVNIGGHVFKGILYDQGPEN 141
                             1.233456789999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051421.4E-5810140IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016233.6E-271354IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.6E-2492139IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MMRPAGSLGG SRCQDCGNQS KKDCFYMRCR TCCKSKGFQC QTHVKSTWVP AYRRRQRAQT  60
VSPVQQQQLL GQNPKSKRLR ENPSTGLEIE NFPAEVDSTA TFRCFRVSSI DEAVDQLAYQ  120
TSVNIGGHVF KGILYDQGPE NRYDFGETSC RELHQEPNLT NAGALTPALA STSGAAESLA  180
PPSYSFPLNA FMSGTQLFLH PKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047685.11e-127PREDICTED: protein SHI RELATED SEQUENCE 1
RefseqXP_011047676.11e-127PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9XGX04e-61SHI_ARATH; Protein SHORT INTERNODES
TrEMBLB9HRI11e-123B9HRI1_POPTR; Uncharacterized protein (Fragment)
STRINGPOPTR_0009s12450.11e-123(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99692541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66350.12e-62Lateral root primordium (LRP) protein-related